Lineage for d5jo4b2 (5jo4 B:108-215)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (925 PDB entries)
  8. 2353408Domain d5jo4b2: 5jo4 B:108-215 [341199]
    Other proteins in same PDB: d5jo4b1, d5jo4d1
    automated match to d1dn0a2
    complexed with so4

Details for d5jo4b2

PDB Entry: 5jo4 (more details), 2.53 Å

PDB Description: antibody fab fragment complex
PDB Compounds: (B:) D80 Fab Light Chain

SCOPe Domain Sequences for d5jo4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jo4b2 b.1.1.2 (B:108-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5jo4b2:

Click to download the PDB-style file with coordinates for d5jo4b2.
(The format of our PDB-style files is described here.)

Timeline for d5jo4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jo4b1