SCOPe 2.06: Domain d6bf2a1: 6bf2 A:4-212

Lineage for d6bf2a1 (6bf2 A:4-212)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (35 PDB entries)

8. Domain d6bf2a1: 6bf2 A:4-212 [341182]
   Other proteins in same PDB: d6bf2a2
   automated match to d1r2ia_
   mutant

Details for d6bf2a1

PDB Entry: 6bf2

PDB Description: solution structure of a bcl-xl s62e mutant

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d6bf2a1:

Sequence; same for both SEQRES and ATOM records:

>d6bf2a1 f.1.4.1 (A:4-212) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpswhla
depavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlep
wiqenggwdtfvelygnnaaaesrkgqer

Timeline for d6bf2a1:

• d6bf2a1 is new in SCOPe 2.06-stable
  
• d6bf2a1 appears in SCOPe 2.07
  
• d6bf2a1 appears in the current release, SCOPe 2.08