Lineage for d6bf2a1 (6bf2 A:4-212)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021136Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 3021137Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)
  8. 3021228Domain d6bf2a1: 6bf2 A:4-212 [341182]
    Other proteins in same PDB: d6bf2a2
    automated match to d1r2ia_
    mutant

Details for d6bf2a1

PDB Entry: 6bf2 (more details)

PDB Description: solution structure of a bcl-xl s62e mutant
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d6bf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bf2a1 f.1.4.1 (A:4-212) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpswhla
depavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlep
wiqenggwdtfvelygnnaaaesrkgqer

SCOPe Domain Coordinates for d6bf2a1:

Click to download the PDB-style file with coordinates for d6bf2a1.
(The format of our PDB-style files is described here.)

Timeline for d6bf2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6bf2a2