Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) |
Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
Protein automated matches [193326] (10 species) not a true protein |
Species Acinetobacter baumannii [TaxId:575584] [196867] (16 PDB entries) |
Domain d5yl8b_: 5yl8 B: [341174] automated match to d4qaja_ complexed with na |
PDB Entry: 5yl8 (more details), 1.79 Å
SCOPe Domain Sequences for d5yl8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yl8b_ c.56.3.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]} msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv pqamnqinaykpa
Timeline for d5yl8b_: