Lineage for d5xr3a1 (5xr3 A:8-292)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2118193Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2118194Protein automated matches [190197] (20 species)
    not a true protein
  7. 2118361Species Staphylococcus aureus [TaxId:158878] [280201] (7 PDB entries)
  8. 2118380Domain d5xr3a1: 5xr3 A:8-292 [341166]
    Other proteins in same PDB: d5xr3a2, d5xr3c2, d5xr3g2
    automated match to d1izya_
    complexed with glv

Details for d5xr3a1

PDB Entry: 5xr3 (more details), 3.01 Å

PDB Description: sav0551 with glyoxylate
PDB Compounds: (A:) Protein/nucleic acid deglycase HchA

SCOPe Domain Sequences for d5xr3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xr3a1 c.23.16.0 (A:8-292) automated matches {Staphylococcus aureus [TaxId: 158878]}
lskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryvll
engkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistynkl
keklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrfiv
tlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltkqg
lkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnk

SCOPe Domain Coordinates for d5xr3a1:

Click to download the PDB-style file with coordinates for d5xr3a1.
(The format of our PDB-style files is described here.)

Timeline for d5xr3a1: