Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
Protein automated matches [190071] (5 species) not a true protein |
Species Acinetobacter baumannii [TaxId:400667] [260436] (4 PDB entries) |
Domain d5yl5f_: 5yl5 F: [341163] automated match to d4rhca_ complexed with gol, so4, trs |
PDB Entry: 5yl5 (more details), 1.9 Å
SCOPe Domain Sequences for d5yl5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yl5f_ c.23.13.1 (F:) automated matches {Acinetobacter baumannii [TaxId: 400667]} stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka igvicglgakgysfaldyaiekiqp
Timeline for d5yl5f_: