SCOPe 2.06: Domain d5wl1a1: 5wl1 A:4-183

Lineage for d5wl1a1 (5wl1 A:4-183)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (32 PDB entries)

8. Domain d5wl1a1: 5wl1 A:4-183 [341157]
   Other proteins in same PDB: d5wl1a2, d5wl1a3, d5wl1b_
   automated match to d3l9ra1
   complexed with bma, cl, cuy, d3d, edo, fuc, iod, man, na, nag

Details for d5wl1a1

PDB Entry: 5wl1, 1.38 Å

PDB Description: crystal structure of human cd1b in complex with pg

PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5wl1a1:

Sequence; same for both SEQRES and ATOM records:

>d5wl1a1 d.19.1.1 (A:4-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev
aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf
lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

Timeline for d5wl1a1:

• d5wl1a1 is new in SCOPe 2.06-stable
  
• d5wl1a1 appears in the current release, SCOPe 2.07