SCOPe 2.06: Domain d5xjeb1: 5xje B:230-339

Lineage for d5xjeb1 (5xje B:230-339)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5xjeb1: 5xje B:230-339 [341152]
   Other proteins in same PDB: d5xjec1
   automated match to d1hzhk3
   complexed with bma, cl, fuc, gal, man, nag

Details for d5xjeb1

PDB Entry: 5xje, 2.4 Å

PDB Description: crystal structure of fucosylated igg1 fc complexed with bis- glycosylated soluble form of fc gamma receptor iiia

PDB Compounds: (B:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d5xjeb1:

Sequence; same for both SEQRES and ATOM records:

>d5xjeb1 b.1.1.2 (B:230-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
papellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnakt
kpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d5xjeb1:

• d5xjeb1 is new in SCOPe 2.06-stable
  
• d5xjeb1 appears in SCOPe 2.07
  
• d5xjeb1 appears in the current release, SCOPe 2.08