Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d5xjea2: 5xje A:340-444 [341148] Other proteins in same PDB: d5xjec1, d5xjec2 automated match to d4dz8a2 complexed with cl |
PDB Entry: 5xje (more details), 2.4 Å
SCOPe Domain Sequences for d5xjea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xjea2 b.1.1.2 (A:340-444) automated matches {Human (Homo sapiens) [TaxId: 9606]} kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls
Timeline for d5xjea2:
View in 3D Domains from other chains: (mouse over for more information) d5xjeb1, d5xjeb2, d5xjec1, d5xjec2 |