SCOPe 2.08: Domain d5xz0b2: 5xz0 B:122-236

Lineage for d5xz0b2 (5xz0 B:122-236)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein automated matches [226944] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225287] (3 PDB entries)

8. Domain d5xz0b2: 5xz0 B:122-236 [341144]
   Other proteins in same PDB: d5xz0a1, d5xz0b1
   automated match to d3gp7b2
   mutant

Details for d5xz0b2

PDB Entry: 5xz0, 3 Å

PDB Description: staphylococcal enterotoxin b (seb) mutant s19 - n23a, y90a, r110a and f177a

PDB Compounds: (B:) staphylococcal enterotoxin b

SCOPe Domain Sequences for d5xz0b2:

Sequence; same for both SEQRES and ATOM records:

>d5xz0b2 d.15.6.1 (B:122-236) automated matches {Staphylococcus aureus [TaxId: 93062]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyeannsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt

Timeline for d5xz0b2:

• d5xz0b2 first appeared in SCOPe 2.06
  
• d5xz0b2 appears in SCOPe 2.07