SCOPe 2.06: Domain d5ylaa_: 5yla A:

Lineage for d5ylaa_ (5yla A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (10 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (16 PDB entries)

8. Domain d5ylaa_: 5yla A: [341129]
   automated match to d4qaja_

Details for d5ylaa_

PDB Entry: 5yla, 1.68 Å

PDB Description: crystal structure of a dimeric peptidyl-trna hydrolase from acinetobacter baumannii at 1.67 a resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5ylaa_:

Sequence; same for both SEQRES and ATOM records:

>d5ylaa_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

Timeline for d5ylaa_:

• d5ylaa_ is new in SCOPe 2.06-stable
  
• d5ylaa_ appears in SCOPe 2.07
  
• d5ylaa_ appears in the current release, SCOPe 2.08