Lineage for d5wkia1 (5wki A:6-183)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183548Protein automated matches [191280] (4 species)
    not a true protein
  7. 2183558Species Human (Homo sapiens) [TaxId:9606] [189896] (32 PDB entries)
  8. 2183607Domain d5wkia1: 5wki A:6-183 [341121]
    Other proteins in same PDB: d5wkia2, d5wkib_, d5wkid1, d5wkid2, d5wkie1, d5wkie2
    automated match to d3l9ra1
    complexed with act, cl, cuy, d3d, edo, fuc, na, nag

Details for d5wkia1

PDB Entry: 5wki (more details), 2.75 Å

PDB Description: crystal structure of pg90 tcr-cd1b-pg complex
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5wkia1:

Sequence, based on SEQRES records: (download)

>d5wkia1 d.19.1.1 (A:6-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkevae
leeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldfls
vknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

Sequence, based on observed residues (ATOM records): (download)

>d5wkia1 d.19.1.1 (A:6-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkevae
leeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsaivsflrgalggldflsvk
nascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

SCOPe Domain Coordinates for d5wkia1:

Click to download the PDB-style file with coordinates for d5wkia1.
(The format of our PDB-style files is described here.)

Timeline for d5wkia1: