Lineage for d5wkea1 (5wke A:4-183)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183548Protein automated matches [191280] (4 species)
    not a true protein
  7. 2183558Species Human (Homo sapiens) [TaxId:9606] [189896] (32 PDB entries)
  8. 2183572Domain d5wkea1: 5wke A:4-183 [341076]
    Other proteins in same PDB: d5wkea2, d5wkea3, d5wkeb_
    automated match to d3l9ra1
    complexed with bma, cl, cuy, edo, fuc, man, na, nag, p50

Details for d5wkea1

PDB Entry: 5wke (more details), 1.69 Å

PDB Description: crystal structure of human cd1b in complex with ps
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5wkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wkea1 d.19.1.1 (A:4-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev
aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf
lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

SCOPe Domain Coordinates for d5wkea1:

Click to download the PDB-style file with coordinates for d5wkea1.
(The format of our PDB-style files is described here.)

Timeline for d5wkea1:

View in 3D
Domains from other chains:
(mouse over for more information)
d5wkeb_