Lineage for d5vbxc_ (5vbx C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224218Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 2224219Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 2224252Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 2224253Protein automated matches [191061] (10 species)
    not a true protein
  7. 2224281Species Escherichia coli [TaxId:83333] [341034] (1 PDB entry)
  8. 2224284Domain d5vbxc_: 5vbx C: [341040]
    automated match to d2wdsa_
    complexed with edo, na

Details for d5vbxc_

PDB Entry: 5vbx (more details), 2.05 Å

PDB Description: crystal structure of holo-[acyl-carrier-protein] synthase (acps) from escherichia coli
PDB Compounds: (C:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d5vbxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vbxc_ d.150.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
kafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacat
viies

SCOPe Domain Coordinates for d5vbxc_:

Click to download the PDB-style file with coordinates for d5vbxc_.
(The format of our PDB-style files is described here.)

Timeline for d5vbxc_: