Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
Protein automated matches [191061] (10 species) not a true protein |
Species Escherichia coli [TaxId:83333] [341034] (1 PDB entry) |
Domain d5vbxc_: 5vbx C: [341040] automated match to d2wdsa_ complexed with edo, na |
PDB Entry: 5vbx (more details), 2.05 Å
SCOPe Domain Sequences for d5vbxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vbxc_ d.150.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]} ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa kafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacat viies
Timeline for d5vbxc_: