Lineage for d5pgva_ (5pgv A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102904Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2104213Protein automated matches [190085] (51 species)
    not a true protein
  7. 2104440Species Human (Homo sapiens) [TaxId:9606] [186828] (23 PDB entries)
  8. 2104491Domain d5pgva_: 5pgv A: [341038]
    Other proteins in same PDB: d5pgvb2, d5pgvd2
    automated match to d3dwfc1
    complexed with 8k7, nap; mutant

Details for d5pgva_

PDB Entry: 5pgv (more details), 2.35 Å

PDB Description: crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with 1-(3-hydroxyazetidin-1-yl)-2-[(2s,5r)-2-(4- fluorophenyl)-5-methoxyadamantan-2-yl]ethan-1-one
PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d5pgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pgva_ c.2.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrwtt
llirnpcrkileelystsynmd

SCOPe Domain Coordinates for d5pgva_:

Click to download the PDB-style file with coordinates for d5pgva_.
(The format of our PDB-style files is described here.)

Timeline for d5pgva_: