Lineage for d5vbxb_ (5vbx B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987949Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 2987950Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 2987983Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 2987984Protein automated matches [191061] (11 species)
    not a true protein
  7. 2988012Species Escherichia coli [TaxId:83333] [341034] (3 PDB entries)
  8. 2988020Domain d5vbxb_: 5vbx B: [341035]
    automated match to d2wdsa_
    complexed with edo, na

Details for d5vbxb_

PDB Entry: 5vbx (more details), 2.05 Å

PDB Description: crystal structure of holo-[acyl-carrier-protein] synthase (acps) from escherichia coli
PDB Compounds: (B:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d5vbxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vbxb_ d.150.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
kafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacat
viies

SCOPe Domain Coordinates for d5vbxb_:

Click to download the PDB-style file with coordinates for d5vbxb_.
(The format of our PDB-style files is described here.)

Timeline for d5vbxb_: