Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [340922] (1 PDB entry) |
Domain d6amsa3: 6ams A:246-367 [340991] automated match to d4tr8a3 complexed with po4 |
PDB Entry: 6ams (more details), 2.39 Å
SCOPe Domain Sequences for d6amsa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6amsa3 d.131.1.0 (A:246-367) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} ervlprggdklvvgdrqqlreafsrtailsnekyrgirlqlsngllkiqannpeqeeaee evqveynggnleigfnvsylldvlgvigteqvrfilsdsnssalvheadnddsayvvmpm rl
Timeline for d6amsa3: