Lineage for d5o6sc1 (5o6s C:1-74)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2501389Protein Ubiquitin [54238] (9 species)
  7. 2501491Species Human (Homo sapiens) [TaxId:9606] [54239] (259 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2501841Domain d5o6sc1: 5o6s C:1-74 [340978]
    Other proteins in same PDB: d5o6sa2, d5o6sb2, d5o6sc2, d5o6sd2, d5o6se2, d5o6sf2
    automated match to d5ibkc_

Details for d5o6sc1

PDB Entry: 5o6s (more details), 2.9 Å

PDB Description: ubv.b4r, a dimeric ubiquitin variant binding to birc4 ring
PDB Compounds: (C:) Polyubiquitin-B

SCOPe Domain Sequences for d5o6sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o6sc1 d.15.1.1 (C:1-74) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsdyn
inkkstlllvvkfh

SCOPe Domain Coordinates for d5o6sc1:

Click to download the PDB-style file with coordinates for d5o6sc1.
(The format of our PDB-style files is described here.)

Timeline for d5o6sc1: