Lineage for d5nhma_ (5nhm A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101025Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2101337Family c.1.15.0: automated matches [191634] (1 protein)
    not a true family
  6. 2101338Protein automated matches [191168] (5 species)
    not a true protein
  7. 2101351Species Piromyces sp. [TaxId:73868] [340898] (12 PDB entries)
  8. 2101352Domain d5nhma_: 5nhm A: [340968]
    automated match to d4xkmf_
    complexed with acy, gol, so4

Details for d5nhma_

PDB Entry: 5nhm (more details), 1.67 Å

PDB Description: crystal structure of apo xylose isomerase from piromyces e2
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d5nhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nhma_ c.1.15.0 (A:) automated matches {Piromyces sp. [TaxId: 73868]}
akeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqf
gggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlk
avvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagiel
gaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptk
hqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrg
dyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgm
damaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkq
tsgkqelyeaivamyq

SCOPe Domain Coordinates for d5nhma_:

Click to download the PDB-style file with coordinates for d5nhma_.
(The format of our PDB-style files is described here.)

Timeline for d5nhma_: