Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (25 species) not a true protein |
Species Ailuropoda melanoleuca [TaxId:9646] [340938] (1 PDB entry) |
Domain d5ngha_: 5ngh A: [340939] automated match to d1df3a_ complexed with trs |
PDB Entry: 5ngh (more details), 2.8 Å
SCOPe Domain Sequences for d5ngha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ngha_ b.60.1.0 (A:) automated matches {Ailuropoda melanoleuca [TaxId: 9646]} egndvrrnfdvskisgywysvllasdvrekteenssmrvfvnhievlsnssllfnmhikv dgkcteialvsdktekdgeysveydgynvfrivetdytdyiifhlvnfkekdsfqmmels arepdtseevrkrfveycqkhgivkenifdltevdrclqarg
Timeline for d5ngha_: