Lineage for d5ngha_ (5ngh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805576Species Ailuropoda melanoleuca [TaxId:9646] [340938] (1 PDB entry)
  8. 2805577Domain d5ngha_: 5ngh A: [340939]
    automated match to d1df3a_
    complexed with trs

Details for d5ngha_

PDB Entry: 5ngh (more details), 2.8 Å

PDB Description: structure of odorant binding protein 3 from giant panda (ailuropoda melanoleuca)
PDB Compounds: (A:) Odorant Binding Protein 3

SCOPe Domain Sequences for d5ngha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ngha_ b.60.1.0 (A:) automated matches {Ailuropoda melanoleuca [TaxId: 9646]}
egndvrrnfdvskisgywysvllasdvrekteenssmrvfvnhievlsnssllfnmhikv
dgkcteialvsdktekdgeysveydgynvfrivetdytdyiifhlvnfkekdsfqmmels
arepdtseevrkrfveycqkhgivkenifdltevdrclqarg

SCOPe Domain Coordinates for d5ngha_:

Click to download the PDB-style file with coordinates for d5ngha_.
(The format of our PDB-style files is described here.)

Timeline for d5ngha_: