Lineage for d5n4fa1 (5n4f A:456-726)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152896Species Galerina marginata [TaxId:109633] [340905] (1 PDB entry)
  8. 2152897Domain d5n4fa1: 5n4f A:456-726 [340906]
    automated match to d3iula2
    complexed with gol

Details for d5n4fa1

PDB Entry: 5n4f (more details), 2.4 Å

PDB Description: prolyl oligopeptidase b from galerina marginata - apo protein
PDB Compounds: (A:) prolyl oligopeptidase

SCOPe Domain Sequences for d5n4fa1:

Sequence, based on SEQRES records: (download)

>d5n4fa1 c.69.1.0 (A:456-726) automated matches {Galerina marginata [TaxId: 109633]}
ddfestqvwyeskdgtkipmfivrhkstkfdgtaaaiqygyggfatsadpffspiiltfl
qtygaifavpsirgggefgeewhkggrretkvntfddfiaaaqflvknkyaapgkvaing
asnggllvmgsivrapegtfgaavpeggvadllkfhkftggqawiseygnpsipeefdyi
yplspvhnvrtdkvmpatlitvnigdgrvvpmhsfkfiatlqhnvpqnphpllikidksw
lghgmgkptdknvkdaadkwgfiaralglel

Sequence, based on observed residues (ATOM records): (download)

>d5n4fa1 c.69.1.0 (A:456-726) automated matches {Galerina marginata [TaxId: 109633]}
ddfestqvwyeskdgtkipmfivrhkstkfdgtaaaiqygyggfatsadpffspiiltfl
qtygaifavpsirgggefgeewhkggrretkvntfddfiaaaqflvknkyaapgkvaing
asnggllvmgsivrapegtfgaavpeggvadllkfhkftggqawiseygnpsipeefdyi
yplspvhnvrtdkvmpatlitvnigdgrvvpmhsfkfiatlqhnvpqnphpllikidksw
tdknvkdaadkwgfiaralglel

SCOPe Domain Coordinates for d5n4fa1:

Click to download the PDB-style file with coordinates for d5n4fa1.
(The format of our PDB-style files is described here.)

Timeline for d5n4fa1: