SCOPe 2.06: Domain d5n30a2: 5n30 A:179-303

Lineage for d5n30a2 (5n30 A:179-303)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.272: Dystroglycan, domain 2 [111005] (1 superfamily)
   beta-alpha-beta-X-beta(2)-alpha(2)-beta; antiparallel beta-sheet, order 24153; topological similarity to the ferredoxin-like fold (54861)

4. Superfamily d.272.1: Dystroglycan, domain 2 [111006] (1 family)

5. Family d.272.1.1: Dystroglycan, domain 2 [111007] (2 proteins)

6. Protein automated matches [272735] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [272736] (3 PDB entries)

8. Domain d5n30a2: 5n30 A:179-303 [340897]
   Other proteins in same PDB: d5n30a1
   automated match to d4wiqa2
   complexed with edo, peg; mutant

Details for d5n30a2

PDB Entry: 5n30, 1.8 Å

PDB Description: crystal structure of the v72i mutant of the mouse alpha-dystroglycan n-terminal region

PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d5n30a2:

Sequence; same for both SEQRES and ATOM records:

>d5n30a2 d.272.1.1 (A:179-303) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
acaadepvtvltvildadltkmtpkqridllnrmqsfsevelhnmklvpvvnnrlfdmsa
fmagpgnakkvvengallswklgcslnqnsvpdirgvetparegamsaqlgypvvgwhia
nkkpt

Timeline for d5n30a2:

• d5n30a2 is new in SCOPe 2.06-stable
  
• d5n30a2 appears in SCOPe 2.07
  
• d5n30a2 appears in the current release, SCOPe 2.08