Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) |
Family b.1.6.2: Dystroglycan, N-terminal domain [110062] (2 proteins) |
Protein automated matches [272731] (1 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [272732] (3 PDB entries) |
Domain d5n30a1: 5n30 A:59-162 [340896] Other proteins in same PDB: d5n30a2 automated match to d4wiqa1 complexed with edo, peg; mutant |
PDB Entry: 5n30 (more details), 1.8 Å
SCOPe Domain Sequences for d5n30a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n30a1 b.1.6.2 (A:59-162) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vptvvgipdgtavigrsfrvsiptdliassgeiikvsaagkealpswlhwdphshilegl pldtdkgvhyisvsaarlgangshvpqtssvfsievypedhnep
Timeline for d5n30a1: