Lineage for d3kuza1 (3kuz A:1198-1305)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502649Species Human (Homo sapiens) [TaxId:9606] [187090] (88 PDB entries)
  8. 2502701Domain d3kuza1: 3kuz A:1198-1305 [340875]
    Other proteins in same PDB: d3kuza2, d3kuzb2
    automated match to d3q3ja_
    complexed with unx

Details for d3kuza1

PDB Entry: 3kuz (more details), 2.3 Å

PDB Description: crystal structure of the ubiquitin like domain of plxnc1
PDB Compounds: (A:) Plexin-C1

SCOPe Domain Sequences for d3kuza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kuza1 d.15.1.0 (A:1198-1305) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvalnvvfekipenesadvcrnisvnvldcdtigqakekifqaflskngspyglqlneig
lelqmgtrqkelldidsssviledgitklntighyeisngstikvfkk

SCOPe Domain Coordinates for d3kuza1:

Click to download the PDB-style file with coordinates for d3kuza1.
(The format of our PDB-style files is described here.)

Timeline for d3kuza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kuza2