SCOPe 2.06: Domain d3kuzb1: 3kuz B:1198-1305

Lineage for d3kuzb1 (3kuz B:1198-1305)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)

8. Domain d3kuzb1: 3kuz B:1198-1305 [340873]
   Other proteins in same PDB: d3kuza2, d3kuzb2
   automated match to d3q3ja_
   complexed with unx

Details for d3kuzb1

PDB Entry: 3kuz, 2.3 Å

PDB Description: crystal structure of the ubiquitin like domain of plxnc1

PDB Compounds: (B:) Plexin-C1

SCOPe Domain Sequences for d3kuzb1:

Sequence; same for both SEQRES and ATOM records:

>d3kuzb1 d.15.1.0 (B:1198-1305) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvalnvvfekipenesadvcrnisvnvldcdtigqakekifqaflskngspyglqlneig
lelqmgtrqkelldidsssviledgitklntighyeisngstikvfkk

Timeline for d3kuzb1:

• d3kuzb1 is new in SCOPe 2.06-stable
  
• d3kuzb1 appears in SCOPe 2.07
  
• d3kuzb1 appears in the current release, SCOPe 2.08