Lineage for d5h3ma_ (5h3m A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210162Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2210163Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2210164Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2210181Species Human (Homo sapiens) [TaxId:9606] [55761] (39 PDB entries)
    Uniprot P20065 55-179
  8. 2210274Domain d5h3ma_: 5h3m A: [340861]
    automated match to d1p8zg_

Details for d5h3ma_

PDB Entry: 5h3m (more details)

PDB Description: solution structure of human gelsolin protein domain 1 at ph 5.0
PDB Compounds: (A:) gelsolin

SCOPe Domain Sequences for d5h3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h3ma_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
gfkhvvpnevvvq

SCOPe Domain Coordinates for d5h3ma_:

Click to download the PDB-style file with coordinates for d5h3ma_.
(The format of our PDB-style files is described here.)

Timeline for d5h3ma_: