Lineage for d3fk9b1 (3fk9 B:2-153)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971790Species Bacillus halodurans [TaxId:86665] [340856] (1 PDB entry)
  8. 2971792Domain d3fk9b1: 3fk9 B:2-153 [340858]
    Other proteins in same PDB: d3fk9a2, d3fk9b2
    automated match to d1irya_

Details for d3fk9b1

PDB Entry: 3fk9 (more details), 2.5 Å

PDB Description: crystal structure of mmutator mutt protein from bacillus halodurans
PDB Compounds: (B:) Mutator mutT protein

SCOPe Domain Sequences for d3fk9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fk9b1 d.113.1.0 (B:2-153) automated matches {Bacillus halodurans [TaxId: 86665]}
qrvtncivvdhdqvlllqkprrgwwvapggkmeagesiletvkreyweetgitvknpelk
gifsmvifdegkivsewmlftfkatehegemlkqspegklewkkkdevlelpmaagdkwi
fkhvlhsdrllygtfhytpdfellsyrldpep

SCOPe Domain Coordinates for d3fk9b1:

Click to download the PDB-style file with coordinates for d3fk9b1.
(The format of our PDB-style files is described here.)

Timeline for d3fk9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fk9b2