Lineage for d6eqza1 (6eqz A:3-376)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914784Species Escherichia coli [TaxId:83334] [340846] (3 PDB entries)
  8. 2914788Domain d6eqza1: 6eqz A:3-376 [340851]
    Other proteins in same PDB: d6eqza2, d6eqzb2, d6eqzd2, d6eqzg2
    automated match to d1eu8a_

Details for d6eqza1

PDB Entry: 6eqz (more details), 2.29 Å

PDB Description: a mamc-mic insertion in mbp scaffold at position k170
PDB Compounds: (A:) Maltose-binding periplasmic protein,Tightly bound bacterial magnetic particle protein,Maltose-binding periplasmic protein

SCOPe Domain Sequences for d6eqza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eqza1 c.94.1.1 (A:3-376) automated matches {Escherichia coli [TaxId: 83334]}
eegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifw
ahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdll
pnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyaflkekritnteaai
dtgketvgvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwaw
snidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdeglea
vnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaas
grqtvdealkdaqt

SCOPe Domain Coordinates for d6eqza1:

Click to download the PDB-style file with coordinates for d6eqza1.
(The format of our PDB-style files is described here.)

Timeline for d6eqza1: