Lineage for d5yihb_ (5yih B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2174362Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2174363Protein automated matches [191087] (13 species)
    not a true protein
  7. 2297472Species Acinetobacter baumannii [TaxId:575584] [340773] (1 PDB entry)
  8. 2297512Domain d5yihb_: 5yih B: [340813]
    automated match to d4uoha_
    complexed with mg

Details for d5yihb_

PDB Entry: 5yih (more details), 1.98 Å

PDB Description: crystal structure of tetrameric nucleoside diphosphate kinase at 1.98 a resolution from acinetobacter baumannii
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5yihb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yihb_ d.58.6.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff
gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd
svasaereiayffadneicprtr

SCOPe Domain Coordinates for d5yihb_:

Click to download the PDB-style file with coordinates for d5yihb_.
(The format of our PDB-style files is described here.)

Timeline for d5yihb_:

  • d5yihb_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29