Lineage for d5yfmc_ (5yfm C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2479470Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2479471Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2479472Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 protein domains)
    the active site is between the two identical subunits
  6. 2479566Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species)
  7. 2479567Species Human (Homo sapiens) [TaxId:9606] [110715] (24 PDB entries)
    Uniprot O75874
  8. 2479605Domain d5yfmc_: 5yfm C: [340807]
    automated match to d1t0la_
    complexed with mg, nap

Details for d5yfmc_

PDB Entry: 5yfm (more details), 2.4 Å

PDB Description: human isocitrate dehydrogenase 1 bound with nadp
PDB Compounds: (C:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d5yfmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yfmc_ c.77.1.1 (C:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaaea
ikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvsg
wvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgmy
nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaqk
iwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgktv
eaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleevs
ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaq

SCOPe Domain Coordinates for d5yfmc_:

Click to download the PDB-style file with coordinates for d5yfmc_.
(The format of our PDB-style files is described here.)

Timeline for d5yfmc_: