Lineage for d5xp3d2 (5xp3 D:244-431)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180666Species Pig (Sus scrofa) [TaxId:9823] [278816] (8 PDB entries)
  8. 2297502Domain d5xp3d2: 5xp3 D:244-431 [340803]
    Other proteins in same PDB: d5xp3a1, d5xp3b1, d5xp3c1, d5xp3d1, d5xp3e_, d5xp3f1, d5xp3f2, d5xp3f3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gol, gtp, mes, mg

Details for d5xp3d2

PDB Entry: 5xp3 (more details), 2.3 Å

PDB Description: crystal structure of apo t2r-ttl
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5xp3d2:

Sequence, based on SEQRES records: (download)

>d5xp3d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5xp3d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5xp3d2:

Click to download the PDB-style file with coordinates for d5xp3d2.
(The format of our PDB-style files is described here.)

Timeline for d5xp3d2:

  • d5xp3d2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29