Lineage for d5yiha_ (5yih A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951632Species Acinetobacter baumannii [TaxId:575584] [340773] (1 PDB entry)
  8. 2951633Domain d5yiha_: 5yih A: [340794]
    automated match to d4uoha_
    complexed with mg

Details for d5yiha_

PDB Entry: 5yih (more details), 1.98 Å

PDB Description: crystal structure of tetrameric nucleoside diphosphate kinase at 1.98 a resolution from acinetobacter baumannii
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5yiha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yiha_ d.58.6.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff
gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd
svasaereiayffadneicprtr

SCOPe Domain Coordinates for d5yiha_:

Click to download the PDB-style file with coordinates for d5yiha_.
(The format of our PDB-style files is described here.)

Timeline for d5yiha_: