Class b: All beta proteins [48724] (177 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries) |
Domain d5tnya2: 5tny A:359-457 [340787] Other proteins in same PDB: d5tnya1 automated match to d1lcya1 complexed with mes; mutant |
PDB Entry: 5tny (more details), 1.7 Å
SCOPe Domain Sequences for d5tnya2:
Sequence, based on SEQRES records: (download)
>d5tnya2 b.36.1.0 (A:359-457) automated matches {Human (Homo sapiens) [TaxId: 9606]} rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilsspahraglrpgdvilaige qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevt
>d5tnya2 b.36.1.0 (A:359-457) automated matches {Human (Homo sapiens) [TaxId: 9606]} rryigvmmltlspsilaelqlrepqhgvlihkvilsspahraglrpgdvilaigeqmvqn aedvyeavrtqsqlavqirtltlyvtpevt
Timeline for d5tnya2: