Lineage for d5tnya2 (5tny A:359-457)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056880Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2056881Protein automated matches [190436] (8 species)
    not a true protein
  7. 2056895Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)
  8. 2056998Domain d5tnya2: 5tny A:359-457 [340787]
    Other proteins in same PDB: d5tnya1
    automated match to d1lcya1
    complexed with mes; mutant

Details for d5tnya2

PDB Entry: 5tny (more details), 1.7 Å

PDB Description: htra2 g399s mutant
PDB Compounds: (A:) Serine protease HTRA2, mitochondrial

SCOPe Domain Sequences for d5tnya2:

Sequence, based on SEQRES records: (download)

>d5tnya2 b.36.1.0 (A:359-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilsspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevt

Sequence, based on observed residues (ATOM records): (download)

>d5tnya2 b.36.1.0 (A:359-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepqhgvlihkvilsspahraglrpgdvilaigeqmvqn
aedvyeavrtqsqlavqirtltlyvtpevt

SCOPe Domain Coordinates for d5tnya2:

Click to download the PDB-style file with coordinates for d5tnya2.
(The format of our PDB-style files is described here.)

Timeline for d5tnya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tnya1