SCOPe 2.08: Domain d5uqxa_: 5uqx A:

Lineage for d5uqxa_ (5uqx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
   Pfam PF00443

6. Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82570] (25 PDB entries)

8. Domain d5uqxa_: 5uqx A: [340766]
   automated match to d1nb8b_
   complexed with 8jp

Details for d5uqxa_

PDB Entry: 5uqx, 2.23 Å

PDB Description: usp7 in complex with gne6776 (6'-amino-4'-ethyl-5'-(4-hydroxyphenyl)- n-methyl-[3,3'-bipyridine]-6-carboxamide)

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 7

SCOPe Domain Sequences for d5uqxa_:

Sequence; same for both SEQRES and ATOM records:

>d5uqxa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
khtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyelq
hsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgkm
vsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglqe
aekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpany
ilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsvr
hctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqk

Timeline for d5uqxa_:

• d5uqxa_ first appeared in SCOPe 2.06
  
• d5uqxa_ appears in SCOPe 2.07