![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (243 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [340705] (1 PDB entry) |
![]() | Domain d5w3ka1: 5w3k A:2-182 [340761] Other proteins in same PDB: d5w3ka2, d5w3kb2 automated match to d4kqxb1 complexed with 9ty, mg, ndp |
PDB Entry: 5w3k (more details), 1.59 Å
SCOPe Domain Sequences for d5w3ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w3ka1 c.2.1.0 (A:2-182) automated matches {Staphylococcus aureus [TaxId: 1280]} ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet t
Timeline for d5w3ka1: