Lineage for d5vpmb_ (5vpm B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060651Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2060659Species Human (Homo sapiens) [TaxId:9606] [50669] (76 PDB entries)
  8. 2297459Domain d5vpmb_: 5vpm B: [340760]
    automated match to d1hrna_
    complexed with 9g7, nag, so4

Details for d5vpmb_

PDB Entry: 5vpm (more details), 2.9 Å

PDB Description: crystal structure of human renin in complex with a biphenylpipderidinylcarbinol
PDB Compounds: (B:) renin

SCOPe Domain Sequences for d5vpmb_:

Sequence, based on SEQRES records: (download)

>d5vpmb_ b.50.1.2 (B:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
dippptgptwalgatfirkfytefdrrnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d5vpmb_ b.50.1.2 (B:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsenslggqivlggsdpqh
yegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmea
lgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdi
ppptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d5vpmb_:

Click to download the PDB-style file with coordinates for d5vpmb_.
(The format of our PDB-style files is described here.)

Timeline for d5vpmb_:

  • d5vpmb_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29