Lineage for d5wjob2 (5wjo B:121-249)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033779Domain d5wjob2: 5wjo B:121-249 [340758]
    Other proteins in same PDB: d5wjoa2, d5wjoc2
    automated match to d2cdfb2
    complexed with cl, edo, na

Details for d5wjob2

PDB Entry: 5wjo (more details), 2.5 Å

PDB Description: crystal structure of the unliganded pg90 tcr
PDB Compounds: (B:) PG90 TCR beta chain

SCOPe Domain Sequences for d5wjob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wjob2 b.1.1.0 (B:121-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d5wjob2:

Click to download the PDB-style file with coordinates for d5wjob2.
(The format of our PDB-style files is described here.)

Timeline for d5wjob2: