SCOPe 2.08: Domain d5wjob1: 5wjo B:2-120

Lineage for d5wjob1 (5wjo B:2-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5wjob1: 5wjo B:2-120 [340757]
   Other proteins in same PDB: d5wjoa2, d5wjoc2
   automated match to d3o4le1
   complexed with cl, edo, na

Details for d5wjob1

PDB Entry: 5wjo, 2.5 Å

PDB Description: crystal structure of the unliganded pg90 tcr

PDB Compounds: (B:) PG90 TCR beta chain

SCOPe Domain Sequences for d5wjob1:

Sequence; same for both SEQRES and ATOM records:

>d5wjob1 b.1.1.0 (B:2-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglp
sdrffaerpegsvstlkiqrtqqedsavylcasslaraqgasntgelffgegsrltvle

Timeline for d5wjob1:

• d5wjob1 first appeared in SCOPe 2.06
  
• d5wjob1 appears in SCOPe 2.07