Lineage for d5wjod2 (5wjo D:121-249)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (889 PDB entries)
  8. 2297443Domain d5wjod2: 5wjo D:121-249 [340744]
    Other proteins in same PDB: d5wjoa2, d5wjoc2
    automated match to d2cdfb2
    complexed with cl, edo, na

Details for d5wjod2

PDB Entry: 5wjo (more details), 2.5 Å

PDB Description: crystal structure of the unliganded pg90 tcr
PDB Compounds: (D:) PG90 TCR beta chain

SCOPe Domain Sequences for d5wjod2:

Sequence, based on SEQRES records: (download)

>d5wjod2 b.1.1.0 (D:121-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Sequence, based on observed residues (ATOM records): (download)

>d5wjod2 b.1.1.0 (D:121-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpdsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgrad

SCOPe Domain Coordinates for d5wjod2:

Click to download the PDB-style file with coordinates for d5wjod2.
(The format of our PDB-style files is described here.)

Timeline for d5wjod2:

  • d5wjod2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29