Lineage for d5wpwa2 (5wpw A:282-458)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070601Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2070602Protein automated matches [190388] (22 species)
    not a true protein
  7. 2297430Species Cocos nucifera [TaxId:13894] [340731] (1 PDB entry)
  8. 2297432Domain d5wpwa2: 5wpw A:282-458 [340733]
    automated match to d1od5a2

Details for d5wpwa2

PDB Entry: 5wpw (more details), 1.85 Å

PDB Description: crystal structure of coconut allergen cocosin
PDB Compounds: (A:) 11S globulin isoform 1

SCOPe Domain Sequences for d5wpwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wpwa2 b.82.1.0 (A:282-458) automated matches {Cocos nucifera [TaxId: 13894]}
gfeetycsmkikqnigdprradvfnprggrittlnseklpilrfiqmsaervvlyrnamv
sphwninahsimyctggrgrvevaddrgetvfdgelrqgqllivpqnfamleragsegfq
lvsiktsdramvstivgktsalrgmpvevlmnsyrlsrdearrvkltrgdevaiftp

SCOPe Domain Coordinates for d5wpwa2:

Click to download the PDB-style file with coordinates for d5wpwa2.
(The format of our PDB-style files is described here.)

Timeline for d5wpwa2:

  • d5wpwa2 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5wpwa1