Lineage for d5yhmk_ (5yhm K:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2440429Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2440879Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 2440880Protein automated matches [191250] (4 species)
    not a true protein
  7. 2440881Species Acinetobacter baumannii [TaxId:400667] [260788] (7 PDB entries)
  8. 2440908Domain d5yhmk_: 5yhm K: [340730]
    automated match to d4rc9a_
    complexed with so4, trs

Details for d5yhmk_

PDB Entry: 5yhm (more details), 1.91 Å

PDB Description: crystal structure of dehydroquinate dehydratase with tris induced oligomerisation at 1.907 angstrom resolution
PDB Compounds: (K:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d5yhmk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yhmk_ c.23.13.0 (K:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
kaigvicglgakgysfaldyaiekiqp

SCOPe Domain Coordinates for d5yhmk_:

Click to download the PDB-style file with coordinates for d5yhmk_.
(The format of our PDB-style files is described here.)

Timeline for d5yhmk_: