SCOPe 2.08: Domain d5w3kb2: 5w3k B:183-327

Lineage for d5w3kb2 (5w3k B:183-327)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [340707] (2 PDB entries)

8. Domain d5w3kb2: 5w3k B:183-327 [340708]
   Other proteins in same PDB: d5w3ka1, d5w3kb1
   automated match to d4kqxb2
   complexed with 9ty, mg, ndp

Details for d5w3kb2

PDB Entry: 5w3k, 1.59 Å

PDB Description: crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex nadph, mg2+ and cpd

PDB Compounds: (B:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d5w3kb2:

Sequence; same for both SEQRES and ATOM records:

>d5w3kb2 a.100.1.0 (B:183-327) automated matches {Staphylococcus aureus [TaxId: 1280]}
fkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyegg
menvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkefy
klreeqhghqiekvgrelremmpfi

Timeline for d5w3kb2:

• d5w3kb2 first appeared in SCOPe 2.06
  
• d5w3kb2 appears in SCOPe 2.07