Lineage for d5w3kb1 (5w3k B:2-182)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (236 species)
    not a true protein
  7. 2297404Species Staphylococcus aureus [TaxId:1280] [340705] (1 PDB entry)
  8. 2297405Domain d5w3kb1: 5w3k B:2-182 [340706]
    Other proteins in same PDB: d5w3ka2, d5w3kb2
    automated match to d4kqxb1
    complexed with 9ty, mg, ndp

Details for d5w3kb1

PDB Entry: 5w3k (more details), 1.59 Å

PDB Description: crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex nadph, mg2+ and cpd
PDB Compounds: (B:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d5w3kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w3kb1 c.2.1.0 (B:2-182) automated matches {Staphylococcus aureus [TaxId: 1280]}
ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
t

SCOPe Domain Coordinates for d5w3kb1:

Click to download the PDB-style file with coordinates for d5w3kb1.
(The format of our PDB-style files is described here.)

Timeline for d5w3kb1:

  • d5w3kb1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5w3kb2