Lineage for d5yfka_ (5yfk A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074754Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 2074755Superfamily b.100.1: Sortase [63817] (2 families) (S)
  5. 2297400Family b.100.1.0: automated matches [340701] (1 protein)
    not a true family
  6. 2297401Protein automated matches [340702] (1 species)
    not a true protein
  7. 2297402Species Clostridium perfringens [TaxId:195102] [340703] (1 PDB entry)
  8. 2297403Domain d5yfka_: 5yfk A: [340704]
    automated match to d2oqza_
    mutant

Details for d5yfka_

PDB Entry: 5yfk (more details), 1.8 Å

PDB Description: x-ray structure of a mutant form c232s of clostridium perfringens sortase b
PDB Compounds: (A:) Uncharacterized protein Sortase B

SCOPe Domain Sequences for d5yfka_:

Sequence, based on SEQRES records: (download)

>d5yfka_ b.100.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 195102]}
yytdsrdydnlrslsplsdssvnkspeehkqdaeseknlkninpdyrfwikvegtnidfp
vvqgkdndfylhhnfnkeksfsgsifvdsennlnddsnivvyghnmrndtmfaqikhfkn
enffnankyvtlyregkkstfeifsvyqenakdleseiktkfsnkedyekylkeqesksl
fkrdgidlnsndriltlitsgydfvnarivvvakeid

Sequence, based on observed residues (ATOM records): (download)

>d5yfka_ b.100.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 195102]}
yytdsrdydnlrslsplsspeehkqdaeseknlkninpdyrfwikvegtnidfpvvqgkd
ndfylhhnfnkeksfsgsifvdsennlnddsnivvyghnmrndtmfaqikhfknenffna
nkyvtlyregkkstfeifsvyqenakdleseiktkfsnkedyekylkeqeskslfkrdgi
dlnsndriltlitsgydfvnarivvvakeid

SCOPe Domain Coordinates for d5yfka_:

Click to download the PDB-style file with coordinates for d5yfka_.
(The format of our PDB-style files is described here.)

Timeline for d5yfka_:

  • d5yfka_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29