Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Chymosin (synonym: renin) [50667] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50669] (77 PDB entries) |
Domain d5v8vb_: 5v8v B: [340695] automated match to d1hrna_ complexed with 90d, nag |
PDB Entry: 5v8v (more details), 2.6 Å
SCOPe Domain Sequences for d5v8vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v8vb_ b.50.1.2 (B:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham dippptgptwalgatfirkfytefdrrnnrigfalar
Timeline for d5v8vb_: