Lineage for d5x23a_ (5x23 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (39 PDB entries)
  8. 2297393Domain d5x23a_: 5x23 A: [340694]
    automated match to d2vn0a_
    complexed with hem, k, lsn, po4

Details for d5x23a_

PDB Entry: 5x23 (more details), 2 Å

PDB Description: crystal structure of cyp2c9 genetic variant a477t (*30) in complex with multiple losartan molecules
PDB Compounds: (A:) Cytochrome P450 2C9

SCOPe Domain Sequences for d5x23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x23a_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvlhgyeavkeal
idlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrvqe
earclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklneniki
lsspwiqicnnfspiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfidcf
lmkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhpevtakvqeei
ervigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgtti
lisltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmelfl
fltsilqnfnlkslvdpknldttpvvngftsvppfyqlcfipi

SCOPe Domain Coordinates for d5x23a_:

Click to download the PDB-style file with coordinates for d5x23a_.
(The format of our PDB-style files is described here.)

Timeline for d5x23a_:

  • d5x23a_ appears in periodic updates to SCOPe 2.06 starting on 2017-10-29