SCOPe 2.06: Domain d5okbc_: 5okb C:

Lineage for d5okbc_ (5okb C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [319127] (17 PDB entries)

8. Domain d5okbc_: 5okb C: [340691]
   automated match to d1pbga_
   complexed with gol, imd, po4

Details for d5okbc_

PDB Entry: 5okb, 1.33 Å

PDB Description: high resolution structure of native gan1d, a putative 6-phospho-beta- galactosidase from geobacillus stearothermophilus

PDB Compounds: (C:) Putative 6-phospho-beta-galactobiosidase

SCOPe Domain Sequences for d5okbc_:

Sequence; same for both SEQRES and ATOM records:

>d5okbc_ c.1.8.0 (C:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael

Timeline for d5okbc_:

• d5okbc_ is new in SCOPe 2.06-stable
  
• d5okbc_ appears in SCOPe 2.07
  
• d5okbc_ appears in the current release, SCOPe 2.08