Lineage for d5to0a1 (5to0 A:142-344)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055631Family b.47.1.1: Prokaryotic proteases [50495] (16 protein domains)
  6. 2055830Protein automated matches [190306] (7 species)
    not a true protein
  7. 2278866Species Homo sapiens [TaxId:9606] [322167] (7 PDB entries)
  8. 2297384Domain d5to0a1: 5to0 A:142-344 [340685]
    Other proteins in same PDB: d5to0a2, d5to0a3
    automated match to d1lcya2
    complexed with mes; mutant

Details for d5to0a1

PDB Entry: 5to0 (more details), 1.9 Å

PDB Description: htra2 s276c mutant
PDB Compounds: (A:) Serine protease HTRA2, mitochondrial

SCOPe Domain Sequences for d5to0a1:

Sequence, based on SEQRES records: (download)

>d5to0a1 b.47.1.1 (A:142-344) automated matches {Homo sapiens [TaxId: 9606]}
sprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvva
drrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvamg
spfalqntitsgivcsaqrpardlglpqtnveyiqtdaaidfgnsggplvnldgevigvn
tmkvtagisfaipsdrlreflhr

Sequence, based on observed residues (ATOM records): (download)

>d5to0a1 b.47.1.1 (A:142-344) automated matches {Homo sapiens [TaxId: 9606]}
sprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvva
drrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvamg
spfalqntitsgivcsaqnveyiqtdaaidfgnsggplvnldgevigvntmkvtagisfa
ipsdrlreflhr

SCOPe Domain Coordinates for d5to0a1:

Click to download the PDB-style file with coordinates for d5to0a1.
(The format of our PDB-style files is described here.)

Timeline for d5to0a1:

  • d5to0a1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29