Lineage for d5v8va_ (5v8v A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2392953Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2392961Species Human (Homo sapiens) [TaxId:9606] [50669] (76 PDB entries)
  8. 2393083Domain d5v8va_: 5v8v A: [340684]
    automated match to d1hrna_
    complexed with 90d, nag

Details for d5v8va_

PDB Entry: 5v8v (more details), 2.6 Å

PDB Description: crystal structure of human renin in complex with a biphenylpipderidinylcarbinol
PDB Compounds: (A:) renin

SCOPe Domain Sequences for d5v8va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v8va_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
dippptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d5v8va_:

Click to download the PDB-style file with coordinates for d5v8va_.
(The format of our PDB-style files is described here.)

Timeline for d5v8va_: