Lineage for d5xp3c1 (5xp3 C:1-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2107920Species Pig (Sus scrofa) [TaxId:9823] [278808] (8 PDB entries)
  8. 2297378Domain d5xp3c1: 5xp3 C:1-245 [340679]
    Other proteins in same PDB: d5xp3a2, d5xp3b2, d5xp3c2, d5xp3d2, d5xp3e_, d5xp3f1, d5xp3f2, d5xp3f3
    automated match to d4ihja1
    complexed with acp, ca, gdp, gol, gtp, mes, mg

Details for d5xp3c1

PDB Entry: 5xp3 (more details), 2.3 Å

PDB Description: crystal structure of apo t2r-ttl
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5xp3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xp3c1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5xp3c1:

Click to download the PDB-style file with coordinates for d5xp3c1.
(The format of our PDB-style files is described here.)

Timeline for d5xp3c1:

  • d5xp3c1 appears in periodic updates to SCOPe 2.06 starting on 2017-10-29